LL-37 trifluoroacetate salt,CAS : 154947-66-7
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt
Product description
LL-37 is an antimicrobial peptide with angiogenic activity. LL-37 has been suggested to stimulate epithelial cell proliferation partially through formyl peptide receptor-like 1 (FPRL1) since blocking the receptor with pertussis toxin decreased the proliferative effect of LL-37 by approximately 50 %.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 154947-66-7 |
Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Synonyms | LL37, Antibacterial Protein LL-37 (human), CAMP |
Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product